1. Recombinant Proteins
  2. Others
  3. Decorin/PGS2 Protein, Rat (HEK293, His)

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Decorin/PGS2 Protein, Rat (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Decorin/PGS2 Protein, Rat (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Decorin/PGS2 Protein is implicated in influencing the rate of fibril formation, suggesting a role in the modulation of extracellular matrix dynamics. Additionally, it may play a part in the dilatation of the rat cervix. The protein exhibits a versatile binding profile, interacting with type I and type II collagen, fibronectin, and TGF-beta, indicating its involvement in diverse cellular processes. Furthermore, Decorin forms a ternary complex with MFAP2 and ELN, highlighting its engagement in complex molecular interactions within the extracellular environment. Its interaction with DPT further underscores its involvement in the regulation of structural and signaling components. A comprehensive exploration of Decorin's functions and its interplay with various molecular partners could provide valuable insights into its multifaceted role in extracellular matrix biology and tissue physiology.

Biological Activity

Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q01129 (G17-K354)

Gene ID
Molecular Construction
N-term
PGS2 (G17-K354)
Accession # Q01129
His
C-term
Synonyms
Decorin; Bone proteoglycan II; PG-S2; PG40; DCN; SLRR1B
AA Sequence

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK

Molecular Weight

Approximately 43-48 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Decorin/PGS2 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Decorin/PGS2 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74202
Quantity:
MCE Japan Authorized Agent: