Decorin/PGS2 Protein, Rat (HEK293, His)

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

Decorin/PGS2 Protein is implicated in influencing the rate of fibril formation, suggesting a role in the modulation of extracellular matrix dynamics. Additionally, it may play a part in the dilatation of the rat cervix. The protein exhibits a versatile binding profile, interacting with type I and type II collagen, fibronectin, and TGF-beta, indicating its involvement in diverse cellular processes. Furthermore, Decorin forms a ternary complex with MFAP2 and ELN, highlighting its engagement in complex molecular interactions within the extracellular environment. Its interaction with DPT further underscores its involvement in the regulation of structural and signaling components. A comprehensive exploration of Decorin's functions and its interplay with various molecular partners could provide valuable insights into its multifaceted role in extracellular matrix biology and tissue physiology.

Rat

HEK293

C-6*His

Q01129 (G17-K354)

29139  [NCBI]

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK

Approximately 43-48 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.