1. Recombinant Proteins
  2. Others
  3. Dermatopontin/DPT Protein, Mouse (HEK293, Fc)

The dermapontin (DPT) protein mediates adhesion by binding to integrins on the cell surface and serves as a communication link between dermal fibroblasts and the extracellular matrix. It enhances TGFB1 activity, inhibits cell proliferation, accelerates collagen fiber formation, and stabilizes its resistance to low-temperature dissociation. Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is 183 a.a., with molecular weight of ~55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The dermapontin (DPT) protein mediates adhesion by binding to integrins on the cell surface and serves as a communication link between dermal fibroblasts and the extracellular matrix. It enhances TGFB1 activity, inhibits cell proliferation, accelerates collagen fiber formation, and stabilizes its resistance to low-temperature dissociation. Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is 183 a.a., with molecular weight of ~55 kDa.

Background

Dermatopontin (DPT) protein functions as a mediator of adhesion through binding to cell surface integrins and acts as a potential communication link between dermal fibroblast cell surfaces and the extracellular matrix. Additionally, DPT enhances the activity of TGFB1, inhibits cell proliferation, and plays a role in accelerating collagen fibril formation while stabilizing collagen fibrils against low-temperature dissociation. Its interactions with TGFB1, DCN, and collagen underscore its involvement in the modulation of cellular adhesion and extracellular matrix dynamics.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9QZZ6 (Q19-V201)

Gene ID
Molecular Construction
N-term
DPT (Q19-V201)
Accession # Q9QZZ6
hFc
C-term
Synonyms
rMuDermatopontin, Fc; Early quiescence protein 1; EQ-1; Tyrosine-rich acidic matrix protein; TRAMP
AA Sequence

QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENV

Molecular Weight

Approximately 55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Dermatopontin/DPT Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Dermatopontin/DPT Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70104
Quantity:
MCE Japan Authorized Agent: