DFFA Protein, Human (GST)

DFFA Protein is a heterodimeric complex of nuclease CAD and its specific inhibitor ICAD. DFFA Protein, Human (GST) is a substrate for caspase-3 that triggers DNA breakage during apoptosis. DFFA Protein, Human (GST) is the recombinant human-derived DFFA protein, expressed by E. coli , with N-GST labeled tag. The total length of DFFA Protein, Human (GST) is 331 a.a., with molecular weight of 63.6 kDa.

DNA fragmentation factor subunit alpha DNA (DFFA), also known as Caspase-activated DNase inhibitor (ICAD), is a human protein encoded by the DFFA gene. DFFA and DFFB are subunits of DNA break factor (DFF), substrates of caspase-3 that trigger DNA break during apoptosis. The C-terminal domain of DFFA (DFF-C) consists of four alpha-helices folded into a helical arrangement, with alpha-2 and alpha-3 arranged on a long C-terminal helix (alpha-4). The main function of this domain is to bind to the C-terminal catalytic domain of DFFB through ionic interactions, thereby inhibiting DNA breakage during apoptosis. DFFA plays an important role in cancer development^[1][2][3][4].

Human

E. coli

N-GST

O00273 (M1-T331)

1676  [NCBI]

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

63.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.