1. Recombinant Proteins
  2. Others
  3. DHH Protein, Human

The DHH protein is cleaved into N- and C-product fragments through autoproteolysis and cholesterol transferase activity, where the N-product acquires the cholesterol moiety. In the endoplasmic reticulum, DHH is critical for juxtocrine signaling, endothelial integrity, and Schwann cell-mediated nerve sheath development. DHH Protein, Human (Tag Free) is the recombinant human-derived DHH protein, expressed by E. coli , with tag free. The total length of DHH Protein, Human (Tag Free) is 175 a.a., with molecular weight of ~20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DHH protein is cleaved into N- and C-product fragments through autoproteolysis and cholesterol transferase activity, where the N-product acquires the cholesterol moiety. In the endoplasmic reticulum, DHH is critical for juxtocrine signaling, endothelial integrity, and Schwann cell-mediated nerve sheath development. DHH Protein, Human (Tag Free) is the recombinant human-derived DHH protein, expressed by E. coli , with tag free. The total length of DHH Protein, Human (Tag Free) is 175 a.a., with molecular weight of ~20 kDa.

Background

The DHH protein precursor exhibits autoproteolysis and cholesterol transferase activity in its C-terminal region, leading to the cleavage of the full-length protein into N-product and C-product fragments, with the addition of a cholesterol moiety to the newly generated N-product. These processes occur in the endoplasmic reticulum. DHH plays a crucial role in cell-cell-mediated juxtacrine signaling and promotes endothelial integrity. It binds to the PTCH1 receptor, in association with SMO, activating the transcription of target genes in endothelial cells. In Schwann cells, DHH controls the development of the peripheral nerve sheath and the transition of mesenchymal cells into the perineurial tube's epithelium-like structure. The lipidated DHH N-product is vital for various developmental patterning events, binding to PTCH1 and activating target gene transcription. DHH is essential for normal testis development, spermatogenesis, and the formation of adult-type Leydig cells, as well as the development of peritubular cells and seminiferous tubules. Additionally, DHH activates primary cilia signaling in neighboring valve interstitial cells through paracrine mechanisms and may induce motor neurons in the lateral neural tube while preventing binding of the DHH protein precursor to PTCH1.

Biological Activity

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 1.729 µg/mL, corresponding to a specific activity is 5.817×102 U/mg.

  • Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 1.729 µg/mL, corresponding to a specific activity is 5.817×102 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O43323 (G24-G198)

Gene ID

50846

Molecular Construction
N-term
DHH (G24-G198)
Accession # O43323
C-term
Synonyms
rHuDHH; DHH; HHG-3
AA Sequence

GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DHH Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DHH Protein, Human
Cat. No.:
HY-P700605
Quantity:
MCE Japan Authorized Agent: