DKK-1 Protein, Rat (HEK293, C-His)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, C-His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

DKK-1 Protein is predicted to play a crucial role in co-receptor binding, low-density lipoprotein particle receptor binding, and receptor antagonist activity. It is involved in the negative regulation of ossification and the positive regulation of neuron death, and its primary localization is in the extracellular space. This protein is implicated in anodontia, and its biased expression pattern is evident, with notable levels observed in the kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. DKK-1's involvement in the WNT signaling pathway and its impact on visual epilepsy make it a significant factor in both developmental and neurological contexts.

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED₅₀ for this effect is approximately 0.1097 μg/ml in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

• 
  Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED₅₀ for this effect is approximately 0.1097 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

Rat

HEK293

C-6*His

A6I0Z0/NP_001099820.1 (T32-H270)

293897  [NCBI]

TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Approximately 38.58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.