DKK-1 Protein, Mouse (HEK293, His)

DKK-1 protein antagonizes canonical Wnt signaling by inhibiting LRP5/6-Wnt interaction and forming a ternary complex with KREMEN, thereby promoting LRP5/6 internalization. In addition to its Wnt-dependent role, DKK1 has Wnt-independent anti-apoptotic activity by inhibiting the pro-apoptotic function of KREMEN1. DKK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DKK1 protein, expressed by HEK293 , with C-His labeled tag.

DKK1 protein serves as a potent antagonist of canonical Wnt signaling through multiple mechanisms, including inhibiting the interaction between LRP5/6 and Wnt and forming a ternary complex with the transmembrane protein KREMEN, which facilitates the internalization of LRP5/6. Additionally, DKK1 exhibits Wnt-independent anti-apoptotic activity by inhibiting the pro-apoptotic function of KREMEN1. In limb development, DKK1 plays a crucial role by attenuating Wnt signaling, contributing to normal limb patterning. The protein's interactions with LRP5, LRP6, and KREM1, especially in the presence of MESD, highlight its involvement in the intricate regulation of Wnt-mediated signaling pathways, underscoring its significance in various cellular processes and developmental contexts.

Measured by its ability to inhibit recombinant rmWnt3a induced alkaline phosphatase production by C3H10T 1/2 cells and the ED₅₀ is 0.05-0.3 μg/mL.

• 
  Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED₅₀ for this effect is approximately 0.0762 μg/mL in the presence of 10 ng/mL of Human Wnt3a, corresponding to a specific activity is 1.312×10⁴ units/mg.

Mouse

HEK293

C-His

O54908 (T32-H272)

13380  [NCBI]

TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH

Approximately 38.29 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.