DLK-1 Protein, Human (S260N, HEK293, His)

DLK-1 Protein is implicated in neuroendocrine differentiation, signifying its role in cellular specialization. It acts as an inhibitor of adipocyte differentiation, regulating adipogenesis. Structurally, DLK-1 exists as a monomer, defining its molecular composition in these processes. Interactions with SH3RF2 underscore its engagement with cellular components and potential regulatory pathways. DLK-1 Protein, Human (S260N, HEK293, His) is the recombinant human-derived DLK-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DLK-1 Protein, Human (S260N, HEK293, His) is 274 a.a., with molecular weight of 35-45 kDa.

The DLK-1 protein is implicated in potential roles related to neuroendocrine differentiation, indicating its involvement in the complex processes governing cellular specialization. Moreover, it functions as an inhibitor of adipocyte differentiation, suggesting a regulatory role in adipogenesis. Structurally, DLK-1 exists as a monomer, highlighting its singular molecular composition in these physiological processes. Additionally, the protein interacts with SH3RF2, emphasizing its engagement with other cellular components and potential regulatory pathways, as inferred by similarity.

Human

HEK293

C-6*His

AAH13197.1 (A24-P297, S260N)

8788  [NCBI]

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTP

35-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.