1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DPEP1 Protein, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DPEP1 Protein, Human (HEK293, His) is 369 a.a., with molecular weight of ~41.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DPEP1 Protein, Human (HEK293, His) is 369 a.a., with molecular weight of ~41.0 kDa.

Background

Dipeptidase 1 (DPEP1) exhibits versatile enzymatic functions, hydrolyzing a broad spectrum of dipeptides, including the conversion of leukotriene D4 to leukotriene E4. Additionally, it plays a role in the degradation of cystinyl-bis-glycine formed during glutathione breakdown. Notably, DPEP1 showcases beta lactamase activity, enabling the hydrolysis of the beta-lactam antibiotic imipenem. Beyond its enzymatic functions, DPEP1 acts as an adhesion receptor, facilitating neutrophil recruitment from the bloodstream into inflamed lungs and liver independently of its dipeptidase activity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P16444 (D17-S385)

Gene ID
Molecular Construction
N-term
DPEP1 (D17-S385)
Accession # P16444
6*His
C-term
Synonyms
rHuDipeptidase 1/DPEP1, His; Dipeptidase 1; Dehydropeptidase-I; Microsomal Dipeptidase; Renal Dipeptidase; hRDP; DPEP1; MDP; RDP
AA Sequence

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Weight

Approximately 41.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

DPEP1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DPEP1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70003
Quantity:
MCE Japan Authorized Agent: