DPEP1 Protein, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DPEP1 Protein, Human (HEK293, His) is 369 a.a., with molecular weight of ~41.0 kDa.

Dipeptidase 1 (DPEP1) exhibits versatile enzymatic functions, hydrolyzing a broad spectrum of dipeptides, including the conversion of leukotriene D4 to leukotriene E4. Additionally, it plays a role in the degradation of cystinyl-bis-glycine formed during glutathione breakdown. Notably, DPEP1 showcases beta lactamase activity, enabling the hydrolysis of the beta-lactam antibiotic imipenem. Beyond its enzymatic functions, DPEP1 acts as an adhesion receptor, facilitating neutrophil recruitment from the bloodstream into inflamed lungs and liver independently of its dipeptidase activity.

Human

HEK293

C-6*His

P16444 (D17-S385)

1800  [NCBI]

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Approximately 41.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.