DPEP2 Protein, Human (HEK293, His)

The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, His) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-His labeled tag.

DPEP2 (Dipeptidase 2) is a versatile protein with dipeptidase activity, exhibiting the ability to hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4), as well as cleave cystinyl-bis-glycine. Beyond its enzymatic functions, DPEP2 possesses an independent role in modulating macrophage inflammatory responses by acting as a regulator of the NF-kappaB inflammatory signaling pathway. This dual functionality suggests that DPEP2 plays a multifaceted role in cellular processes, participating both in the metabolism of bioactive lipids and in the regulation of key inflammatory pathways, showcasing its importance in immune and inflammatory responses.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

Q9H4A9-1 (A33-S376)

64174  [NCBI]

AYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

Approximately 42-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.