1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DPEP2 Protein, Human (HEK293, His)

DPEP2 Protein, Human (HEK293, His)

Cat. No.: HY-P76306
SDS COA Handling Instructions

The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, His) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $110 In-stock
50 μg $290 In-stock
100 μg $465 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, His) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-His labeled tag.

Background

DPEP2 (Dipeptidase 2) is a versatile protein with dipeptidase activity, exhibiting the ability to hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4), as well as cleave cystinyl-bis-glycine. Beyond its enzymatic functions, DPEP2 possesses an independent role in modulating macrophage inflammatory responses by acting as a regulator of the NF-kappaB inflammatory signaling pathway. This dual functionality suggests that DPEP2 plays a multifaceted role in cellular processes, participating both in the metabolism of bioactive lipids and in the regulation of key inflammatory pathways, showcasing its importance in immune and inflammatory responses.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9H4A9-1 (A33-S376)

Gene ID
Molecular Construction
N-term
DPEP2 (A33-S376)
Accession # Q9H4A9-1
His
C-term
Synonyms
Dipeptidase 2; DPEP2; Membrane-bound dipeptidase 2; MBD-2
AA Sequence

AYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

Molecular Weight

Approximately 42-60 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DPEP2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DPEP2 Protein, Human (HEK293, His)
Cat. No.:
HY-P76306
Quantity:
MCE Japan Authorized Agent: