1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Death Receptor 3
  6. DR3/TNFRSF25 Protein, Human (HEK293, Fc)

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DR3/TNFRSF25 Protein serves as the receptor for TNFSF12/APO3L/TWEAK and directly interacts with the adapter TRADD. This interaction leads to the activation of NF-kappa-B and induction of apoptosis. The protein may play a crucial role in regulating lymphocyte homeostasis. It forms homodimers and exhibits strong interactions via the death domains with TNFRSF1 and TRADD, initiating distinct signaling cascades involved in apoptosis and NF-kappa-B signaling. Additionally, DR3/TNFRSF25 interacts with BAG4, contributing to its multifaceted roles in cellular responses.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q93038 (Q25-F201)

Gene ID
Molecular Construction
N-term
DR3 (Q25-F201)
Accession # Q93038
hFc
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 25; Apo-3; LARD; TNFRSF25; DR3; TNFRSF12; WSL; WSL1
AA Sequence

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMF

Molecular Weight

50-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DR3/TNFRSF25 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DR3/TNFRSF25 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72666
Quantity:
MCE Japan Authorized Agent: