DUSP14 Protein, Human (His)

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

The DUSP14 Protein assumes a crucial role in the inactivation of MAP kinases, exhibiting dephosphorylation activity towards ERK, JNK, and p38 MAP-kinases. Its negative regulatory function extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, leading to its inactivation. This mechanism underscores DUSP14's role in modulating the TCR signaling pathway, revealing its involvement in regulating immune responses. The dephosphorylation activity of DUSP14 on key components of MAP kinase cascades highlights its capacity to finely tune cellular signaling, with potential implications for various physiological processes influenced by MAP kinase pathways.

Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is ≤8.219 ng/mL, corresponding to a specific activity is ≥1.217×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 5.031 ng/mL, corresponding to a specific activity is 1.988×10⁵ units/mg.

Human

E. coli

N-6*His

O95147 (M1-H191)

11072  [NCBI]

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

Approximately 21-23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.