1. Recombinant Proteins
  2. Others
  3. EB3/MAPRE3 Protein, Human (His)

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.

Background

EB3, a plus-end tracking protein (+TIP), intricately modulates the dynamics of the microtubule cytoskeleton by binding to the plus-end of microtubules. Functionally, EB3 serves as a promoter of microtubule growth and potentially contributes to spindle function by stabilizing microtubules and anchoring them at centrosomes. Additionally, it acts as a crucial regulator of minus-end microtubule organization, participating in the recruitment of CAMSAP2 to the Golgi apparatus through interaction with the complex formed by AKAP9 and PDE4DIP. This interaction is pivotal for tethering non-centrosomal minus-end microtubules to the Golgi, a process essential for polarized cell movement. EB3 forms homodimers and heterodimers with MAPRE1, binding both monomeric and polymerized GTP-bound tubulin. Its intricate network of interactions includes APC2, DCTN1, SRCIN1, CLIP1, SLAIN2, SLAIN1, AKAP9, and PDE4DIP, underscoring its multifaceted role in microtubule dynamics and cellular organization.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UPY8-1 (M1-Y281)

Gene ID
Molecular Construction
N-term
His
EB3/MAPRE3 (M1-Y281)
Accession # Q9UPY8-1
C-term
Synonyms
Microtubule-associated protein RP/EB family member 3; EBF3; EB3; RP3; MAPRE3
AA Sequence

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Molecular Weight

Approximately 34 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EB3/MAPRE3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EB3/MAPRE3 Protein, Human (His)
Cat. No.:
HY-P75275
Quantity:
MCE Japan Authorized Agent: