1. Recombinant Proteins
  2. Viral Proteins
  3. EBAG9 Protein, Human (His)

EBAG9 Protein, Human (His)

Cat. No.: HY-P76881
Data Sheet SDS COA Handling Instructions

EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag. The total length of EBAG9 Protein, Human (His) is 186 a.a., with molecular weight of ~34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 46 In-stock
10 μg USD 75 In-stock
50 μg USD 215 In-stock
100 μg USD 340 In-stock
500 μg USD 950 In-stock
1 mg USD 1520 In-stock
> 1 mg   Get quote  

Get it December 24 by noon. Order within 16 hrs 23 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag. The total length of EBAG9 Protein, Human (His) is 186 a.a., with molecular weight of ~34 kDa.

Background

The EBAG9 Protein emerges as a potential participant in the suppression of cell proliferation and the induction of apoptotic cell death by activating interleukin-1-beta converting enzyme (ICE)-like proteases. Its homodimeric structure suggests a capacity for self-association, underscoring its potential role in intracellular signaling pathways that regulate cell survival and apoptosis. The engagement of EBAG9 in these processes implies a multifaceted function, where it may contribute to the intricate balance between cell growth and programmed cell death.

Species

Human

Source

E. coli

Tag

N-His

Accession

O00559-1 (R28-S213)

Gene ID
Molecular Construction
N-term
His
EBAG9 (R28-S213)
Accession # O00559-1
C-term
Synonyms
Receptor-binding cancer antigen expressed on SiSo cells; EBAG9; RCAS1
AA Sequence

RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Molecular Weight

Approximately 34 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EBAG9 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EBAG9 Protein, Human (His)
Cat. No.:
HY-P76881
Quantity:
MCE Japan Authorized Agent: