1. Recombinant Proteins
  2. Others
  3. EIF3M Protein, Human (His-SUMO)

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773). EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773). EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

EIF3M protein serves as an integral component of the eukaryotic translation initiation factor 3 (eIF-3) complex, crucial for orchestrating multiple steps in the initiation of protein synthesis. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors such as eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi, and eIF-5 to form the 43S pre-initiation complex (43S PIC). EIF-3M actively promotes mRNA recruitment to the 43S PIC, scanning of the mRNA for AUG recognition, and subsequent prevention of premature joining of the 40S and 60S ribosomal subunits prior to initiation. Furthermore, the EIF-3 complex plays a pivotal role in the disassembly and recycling of post-termination ribosomal complexes. Remarkably, EIF3M is instrumental in the translation initiation of specific mRNAs associated with cell proliferation, encompassing processes like cell cycling, differentiation, and apoptosis. It employs distinct modes of RNA stem-loop binding to exert either translational activation or repression. Additionally, in the context of microbial infection, EIF3M may facilitate virus entry during infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).

Species

Human

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q7L2H7-1 (S2-T374)

Gene ID
Molecular Construction
N-term
6*His-SUMO
EIF3M (S2-T374)
Accession # Q7L2H7-1
C-term
Synonyms
B5; B5 receptor; Dendritic cell protein; eIF3m; EIF3M_HUMAN; Eukaryotic translation initiation factor 3 subunit M; Fetal lung protein B5; FLJ29030; GA17; hfl B5; hFL-B5; PCI domain containing 1 (herpesvirus entry mediator); PCI domain-containing protein 1; PCID1; TANGO7
AA Sequence

SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Molecular Weight

Approximately 58.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

EIF3M Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EIF3M Protein, Human (His-SUMO)
Cat. No.:
HY-P71577
Quantity:
MCE Japan Authorized Agent: