EIF5A2 Protein, Human (His)

EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of EIF5A2 Protein, Human (His) is 153 a.a., with molecular weight of ~22.0 kDa.

EIF5A2, a translation factor, plays a pivotal role in promoting translation elongation and termination, especially when ribosomes encounter specific amino acid sequence contexts leading to stalling. Positioned between the exit (E) and peptidyl (P) sites of the ribosome, EIF5A2 facilitates the rescue of stalled ribosomes, particularly those translating polyproline-containing peptides and other motifs causing ribosomal stalling. Additionally, EIF5A2 serves as a cofactor in ribosome quality control (RQC), aiding the RQC complex in the peptidyl transfer during the CAT tailing step. Beyond its role in translation, EIF5A2 is implicated in actin dynamics, cell cycle progression, mRNA decay, and likely participates in stress response and cell wall integrity maintenance. It exhibits mutually exclusive binding with EEF2/eEF2 on actively translating ribosomes. Notably, EIF5A2 interacts with DAPL1, forming a complex at the polypeptide exit tunnel of hibernating ribosomes, thereby preventing translation.

Human

E. coli

N-6*His

Q9GZV4 (M1-K153)

56648  [NCBI]

MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.