EMAP-II Protein, Human

EMAP-II Protein, Human is a proinflammatory cytokine and chemoattractant of macrophages.

EMAP II is a proinflammatory cytokine and chemoattractant of macrophages^[1]. EMAP-II protein possesses a wide range of activities toward endothelial cells, neutrophils, and monocyte/macrophages in vitro. EMAP-II up-regulates endothelial E and P-selectin expression and release of von Willebrand factor. It is also chemotactic for neutrophils and monocytes and induces release of myeloperoxidase activity from neutrophils^[2].

Human

E. coli

Tag Free

Q12904 (S147-K312)

9255  [NCBI]

SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK

Approximately 18.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Schluesener HJ, et al. Localization of endothelial-monocyte-activating polypeptide II (EMAP II), a novel proinflammatory cytokine, to lesions of experimental autoimmune encephalomyelitis, neuritis and uveitis: expression by monocytes and activated microglial cells. Glia. 1997 Aug;20(4):365-72.  [Content Brief]

  [2]. Barnett G, et al. Prostate adenocarcinoma cells release the novel proinflammatory polypeptide EMAP-II in response to stress. Cancer Res. 2000 Jun 1;60(11):2850-7.  [Content Brief]