Collagen Alpha-1(XVIII) Chain/Endostatin Protein, Human (P.pastoris)

Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.

Recombinant Human Endostatin is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion^[1]. Recombinant Human Endostatin (rhEndostatin) shows a potent bioactivity and is capable of synergizing with CTX and DDP in suppression of tumor cell growth^[2].

The ED₅₀ is 10 μg/mL as measured by Endothelial cells.

Human

P. pastoris

Tag Free

P39060-3 (A1571-K1754)

80781  [NCBI]

AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 17 mM citric-phosphate buffer, pH 6.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Guo ZY, et al. Effect of recombinant human endostatin on the expression of c-Myc and bFGF in mouse gastric cancer cells. Genet Mol Res. 2015 May 18;14(2):5258-65.  [Content Brief]

  [2]. Ren Z, et al. Anti-tumor effect of a novel soluble recombinant human endostatin: administered as a single agent or in combination with chemotherapy agents in mouse tumor models. PLoS One. 2014 Sep 17;9(9):e107823.  [Content Brief]