1. Recombinant Proteins
  2. Viral Proteins
  3. Bacterial/Fungal Proteins
  4. Enterotoxin type C-2 Protein, S. aureus

Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free. The total length of Enterotoxin type C-2 Protein, S. aureus is 239 a.a., with molecular weight of ~27.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Enterotoxin type C-2 (SEC2) activates the host immune system by binding the unprocessed molecule to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex that activates a large number of T lymphocytes and triggers the widespread release of proinflammatory cytokines. Enterotoxin type C-2 Protein, S. aureus is the recombinant Staphylococcus aureus-derived Enterotoxin type C-2 protein, expressed by E. coli , with tag free. The total length of Enterotoxin type C-2 Protein, S. aureus is 239 a.a., with molecular weight of ~27.6 kDa.

Background

Enterotoxin type C-2 (SEC2) is a staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction forms a ternary complex, which subsequently activates a substantial number of T-lymphocytes, initiating a widespread release of pro-inflammatory cytokines. Additionally, SEC2 is implicated in the development of staphylococcal food poisoning syndrome, a condition characterized by symptoms such as gastrointestinal distress and systemic illness.

Species

Staphylococcus aureus

Source

E. coli

Tag

Tag Free

Accession

P34071 (E28-G266)

Gene ID

/

Molecular Construction
N-term
SEC2 (E28-G266)
Accession # P34071
C-term
Synonyms
entC2; Enterotoxin type C-2; SEC2
AA Sequence

ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Molecular Weight

Approximately 27.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Enterotoxin type C-2 Protein, S. aureus Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Enterotoxin type C-2 Protein, S. aureus
Cat. No.:
HY-P71465
Quantity:
MCE Japan Authorized Agent: