1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. EpCAM/TROP1 Protein, Mouse (HEK293, His)

EpCAM/TROP1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P78704
SDS COA Handling Instructions

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 0.3645 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 2.74×10^3 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 0.3645 μg/ml in the presence of 0.5 μg/ml Fibronectin, corresponding to a specific activity is 2.74×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q99JW5/AAH05618.1 (Q24-T266)

Gene ID
Molecular Construction
N-term
EpCAM/TROP1 (Q24-T266)
Accession # Q99JW5/AAH05618.1
His
C-term
Synonyms
EPCAM; TACSTD1; TROP1; CD326; DIAR5; EGP2; EGP314; EGP40; ESA; GA733-2; HNPCC8; HNPCC-8; KS1/4; KSA; M4S1; MIC18; MK1
AA Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Molecular Weight

30-38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as 30-38 kDa under reducing condition (SDS-PAGE) due to glycosylation.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EpCAM/TROP1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P78704
Quantity:
MCE Japan Authorized Agent: