EpCAM/TROP1 Protein, Mouse (HEK293, His)

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.

Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED₅₀ for this effect is 0.3645 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 2.74×10^3 units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED₅₀ for this effect is 0.3645 μg/ml in the presence of 0.5 μg/ml Fibronectin, corresponding to a specific activity is 2.74×10³ units/mg.

Mouse

HEK293

C-His

Q99JW5/AAH05618.1 (Q24-T266)

17075  [NCBI]

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

30-38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as 30-38 kDa under reducing condition (SDS-PAGE) due to glycosylation.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.