Ephrin-A4/EFNA4 Protein, Human (HEK293, Fc)

Ephrin-A4/EFNA4 Protein, a GPI-bound ligand, interacts with Eph receptors, crucial for neuronal, vascular, and epithelial development. It enables migration, repulsion, and adhesion by binding to neighboring Eph receptors, initiating bidirectional signaling. Furthermore, it potentially facilitates the interaction between activated B-lymphocytes and dendritic cells in tonsils. Ephrin-A4/EFNA4 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A4/EFNA4 Protein, Human (HEK293, Fc) is 146 a.a., with molecular weight of ~48.1 & 34.9 kDa, respectively.

Ephrin-A4/EFNA4 Protein is a cell surface GPI-bound ligand that interacts with Eph receptors, a family of receptor tyrosine kinases essential for neuronal, vascular, and epithelial development, enabling migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling. Additionally, Ephrin-A4/EFNA4 Protein may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils.

Human

HEK293

C-hFc

P52798 (L26-G171)

1945  [NCBI]

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG

Approximately 48.1&34.9 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.