Ephrin-A5/EFNA5 Protein, Human (HEK293, Fc)

Ephrin-A5/EFNA5 Protein, a cell surface GPI-bound ligand, crucially interacts with Eph receptors, inducing bidirectional signaling and regulating adhesion, organization, and development in neurons, vasculature, and epithelium. It forms complexes with EPHA3, EPHA8, and ADAM10, impacting internalization and function, while also mediating communication in pancreatic islet cells and influencing brain development. Ephrin-A5/EFNA5 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Human (HEK293, Fc) is 183 a.a., with molecular weight of 55-60 kDa.

Ephrin-A5/EFNA5 Protein is a cell surface GPI-bound ligand that plays a crucial role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases. This interaction leads to contact-dependent bidirectional signaling between adjacent cells. Ephrin-A5/EFNA5 induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to its cognate receptor, and this signaling requires the activity of the Fyn tyrosine kinase. It activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization, and it may also be involved in maintaining lens transparency and stimulating axon fasciculation. Furthermore, Ephrin-A5/EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion and modulates brain development by regulating cell-cell adhesion and repulsion through its interaction with EPHA7. Additionally, Ephrin-A5/EFNA5 binds to EPHB2 and interacts with EPHA8, activating the latter. It also forms a complex with EPHA2, EPHA3, and ADAM10, which regulates the shedding and internalization of Ephrin-A5/EFNA5, thereby influencing its function.

Human

HEK293

C-hFc

P52803 (Q21-N203)

1946  [NCBI]

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

55-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.