1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Ephrin/Eph Family
  4. Ephrins
  5. Ephrin-B1
  6. Ephrin-B1/EFNB1 Protein, Rat (HEK293, Fc)

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Ephrin-B1/EFNB1 protein, a cell surface transmembrane ligand for Eph receptors crucial in neuronal, vascular, and epithelial development, engages in contact-dependent bidirectional signaling by binding to Eph receptors on adjacent cells. With high affinity for the receptor tyrosine kinase EPHB1/ELK, EFNB1 can also bind EPHB2 and EPHB3. In vitro, EFNB1 binds to commissural axons/growth cones, inducing their collapse and potentially playing a role in constraining the orientation of longitudinally projecting axons. The protein's interactions extend to binding with GRIP1 and GRIP2 via its PDZ-binding motif, and it interacts with TLE1. Moreover, EFNB1's intracellular domain peptide interacts with ZHX2, enhancing ZHX2's transcriptional repression activity. These multifaceted interactions underscore EFNB1's role in orchestrating intricate signaling events, contributing to various developmental processes and cellular functions.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P52796 (A25-T229)

Gene ID
Molecular Construction
N-term
EFNB1 (A25-T229)
Accession # P52796
hFc
C-term
Synonyms
Ephrin-B1; EFL-3; ELK-L; LERK-2; Ephrin-B1 CTF; EFNB1; EFL3; EPLG2; LERK2
AA Sequence

MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDT

Molecular Weight

Approximately 58 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Ephrin-B1/EFNB1 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-B1/EFNB1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73029
Quantity:
MCE Japan Authorized Agent: