Epigen Protein, Human

Epigen Protein, Human is a EGF-like growth factor that does not stimulate cells singly expressing ErbB-2, but acts as a mitogen for cells expressing ErbB-1 and co-expressing ErbB-2 in combination with the other ErbBs, with potent mitogenic activity.

Recombinant Human Epigen is a EGF-like growth factor that does not stimulate cells singly expressing ErbB-2, but acts as a mitogen for cells expressing ErbB-1 and co-expressing ErbB-2 in combination with the other ErbBs, with potent mitogenic activity^[1].

The ED₅₀ is <1 μg/mL as measured by 3T3 cells, corresponding to a specific activity of >1 × 10³ units/mg.

Human

E. coli

Tag Free

Q6UW88-2 (A24-A95)

255324  [NCBI]

AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

Approximately 8.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kochupurakkal BS, et al. Epigen, the last ligand of ErbB receptors, reveals intricate relationships between affinity and mitogenicity. J Biol Chem. 2005 Mar 4;280(9):8503-12.  [Content Brief]