1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. EPT1 Protein, Human (GST)

The EPT1 protein is an ethanolamine phosphotransferase that crucially transfers phosphoethanolamine in the final step of PE synthesis. This process is critical for PE production and involves multiple membrane-related cellular functions. EPT1 Protein, Human (GST) is the recombinant human-derived EPT1 protein, expressed by E. coli , with N-GST labeled tag. The total length of EPT1 Protein, Human (GST) is 50 a.a., with molecular weight of ~29.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EPT1 protein is an ethanolamine phosphotransferase that crucially transfers phosphoethanolamine in the final step of PE synthesis. This process is critical for PE production and involves multiple membrane-related cellular functions. EPT1 Protein, Human (GST) is the recombinant human-derived EPT1 protein, expressed by E. coli , with N-GST labeled tag. The total length of EPT1 Protein, Human (GST) is 50 a.a., with molecular weight of ~29.0 kDa.

Background

EPT1 protein serves as an ethanolaminephosphotransferase, facilitating the crucial transfer of phosphoethanolamine (PE) from CDP-ethanolamine to lipid acceptors in the final step of PE synthesis through the 'Kennedy' pathway. This enzymatic process, as elucidated in various studies, is essential for the production of PE, the second most abundant phospholipid in mammalian membranes, and is intricately involved in diverse membrane-related cellular processes. Beyond its primary role in PE synthesis, EPT1 exhibits significance in generating various PE species and may contribute to the synthesis of ether-linked phospholipids, such as plasmanyl- and plasmenyl-PE. This dual functionality suggests its critical involvement in proper myelination and neurodevelopment, emphasizing the multifaceted contributions of EPT1 to cellular lipid metabolism.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9C0D9 (M1-P50)

Gene ID
Molecular Construction
N-term
GST
EPT1 (M1-P50)
Accession # Q9C0D9
C-term
Synonyms
Ethanolaminephosphotransferase 1; hEPT1; Selenoprotein I; SelI; EPT1; KIAA1724; SELI
AA Sequence

MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP

Molecular Weight

Approximately 29.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

EPT1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EPT1 Protein, Human (GST)
Cat. No.:
HY-P70905
Quantity:
MCE Japan Authorized Agent: