EPT1 Protein, Human (GST)

The EPT1 protein is an ethanolamine phosphotransferase that crucially transfers phosphoethanolamine in the final step of PE synthesis. This process is critical for PE production and involves multiple membrane-related cellular functions. EPT1 Protein, Human (GST) is the recombinant human-derived EPT1 protein, expressed by E. coli , with N-GST labeled tag. The total length of EPT1 Protein, Human (GST) is 50 a.a., with molecular weight of ~29.0 kDa.

EPT1 protein serves as an ethanolaminephosphotransferase, facilitating the crucial transfer of phosphoethanolamine (PE) from CDP-ethanolamine to lipid acceptors in the final step of PE synthesis through the 'Kennedy' pathway. This enzymatic process, as elucidated in various studies, is essential for the production of PE, the second most abundant phospholipid in mammalian membranes, and is intricately involved in diverse membrane-related cellular processes. Beyond its primary role in PE synthesis, EPT1 exhibits significance in generating various PE species and may contribute to the synthesis of ether-linked phospholipids, such as plasmanyl- and plasmenyl-PE. This dual functionality suggests its critical involvement in proper myelination and neurodevelopment, emphasizing the multifaceted contributions of EPT1 to cellular lipid metabolism.

Human

E. coli

N-GST

Q9C0D9 (M1-P50)

85465  [NCBI]

MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.