1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens Receptor Proteins Enzymes & Regulators
  3. EGF Superfamily ErbB2/HER2 Stem Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. ErbB2/HER2 EGFR/ErbB family
  5. HER2/CD340 Protein, Rat (His)

The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.

Background

HER2/CD340 Protein, a protein tyrosine kinase, serves as a crucial component within various cell surface receptor complexes, necessitating a coreceptor for ligand binding. While an essential element in the neuregulin-receptor complex, it notably requires the presence of neuregulins for interaction. Additionally, GP30 stands out as a potential ligand for this receptor. Beyond its receptor functions, HER2 plays a key role in the regulation of peripheral microtubules (MTs), influencing their outgrowth and stabilization. Upon activation, the MEMO1-RHOA-DIAPH1 signaling pathway induced by ERBB2 phosphorylates and inhibits GSK3B at the cell membrane, preventing the phosphorylation of APC and CLASP2. This, in turn, facilitates the association of membrane-bound APC with the cell membrane, enabling the localization of MACF1 crucial for microtubule capture and stabilization. Furthermore, HER2 exhibits diverse interactions, including its preferential binding to the tyrosine-phosphorylated form of CPNE3 at the cell membrane, particularly in a growth factor heredulin-dependent manner. In the nucleus, HER2 extends its influence to transcriptional regulation, associating with specific sequences in the PTGS2/COX-2 promoter and activating transcription. It is also implicated in the transcriptional activation of CDKN1A, a process involving STAT3 and SRC, contributing to rRNA gene transcription by RNA Pol I and enhancing protein synthesis and cell growth. The multifaceted roles of HER2 highlight its intricate involvement in cellular processes, spanning from membrane dynamics to transcriptional regulation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Rat

Source

E. coli

Tag

C-6*His

Accession

P06494 (A67-V323)

Gene ID
Molecular Construction
N-term
HER2 (A67-V323)
Accession # P06494
6*His
C-term
Synonyms
Receptor tyrosine-protein kinase erbB-2; p185neu; CD340; Erbb2; Neu
AA Sequence

ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV

Molecular Weight

Approximately 32 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose, 4M Urea, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HER2/CD340 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HER2/CD340 Protein, Rat (His)
Cat. No.:
HY-P72626
Quantity:
MCE Japan Authorized Agent: