1. Recombinant Proteins
  2. Others
  3. ERMAP Protein, Human (HEK293, His)

ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ERMAP protein exhibits a potential role as a cell-adhesion or receptor molecule specifically in erythroid cells. This implies its involvement in mediating interactions or signaling events crucial for erythroid cell function. The precise mechanisms and ligands involved in ERMAP-mediated cell adhesion or receptor activity, as well as its broader implications in erythroid cell biology, warrant further investigation. Unraveling the intricacies of ERMAP's function in erythroid cells may shed light on its significance in hematopoiesis and related physiological processes.

Biological Activity

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 by Jurkat cells. The ED50 for this effect is 1.485 μg/mL. Corresponding to a specific activity is 673.401 U/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96PL5 (H30-A155)

Gene ID
Molecular Construction
N-term
ERMAP (H30-A155)
Accession # Q96PL5
6*His
C-term
Synonyms
Erythroid Membrane-Associated Protein; hERMAP; Radin Blood Group Antigen; Scianna Blood Group Antigen; ERMAP; RD; SC
AA Sequence

HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSA

Molecular Weight

Approximately 16-17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ERMAP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ERMAP Protein, Human (HEK293, His)
Cat. No.:
HY-P70896
Quantity:
MCE Japan Authorized Agent: