EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc)

The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived EPOR-CD131 Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc), has molecular weight of ~110-130 kDa.

The EPOR serves as the receptor for erythropoietin (EPO), playing a crucial role in mediating EPO-induced erythroblast proliferation and differentiation. Upon stimulation by EPO, the EPOR component of the heterodimer undergoes dimerization, initiating the JAK2/STAT5 signaling cascade. In certain cell types, this heterodimeric receptor complex can additionally activate STAT1 and STAT3, and may participate in the activation of the LYN tyrosine kinase. Notably, the isoform EPOR-T acts as a dominant-negative receptor, modulating and attenuating EPOR-mediated signaling pathways. The intricate interplay within the EPORic complex underscores its significance in regulating cellular responses to EPO stimulation.

Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2μg/mL (100μL/well) can bind biotinylated EPO. The ED₅₀ for this effect is 44.91ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2 μg/mL (100 μL/well) can bind biotinylated EPO. The ED₅₀ for this effect is 44.91 ng/mL.

Human

HEK293

C-hFc

P19235 (A25-P250)&P32927 (W17-W443)

2057  [NCBI]&1439  [NCBI]

MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP&WERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMW

Approximately 110-130 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.