1. Recombinant Proteins
  2. Others
  3. ESM-1 Protein, Human (HEK293, His)

ESM-1 Protein, Human (HEK293, His)

Cat. No.: HY-P70151
COA Handling Instructions

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Human (HEK293, His) is the recombinant human-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $375 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

ESM-1 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Human (HEK293, His) is the recombinant human-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ESM-1 (Endocan) plays a crucial role in angiogenesis, promoting the sprouting of new blood vessels. It is implicated in lung endothelial cell-leukocyte interactions, suggesting its potential significance in regulating immune responses within the pulmonary vasculature.

Biological Activity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED 50 for this effect is ≤1.615 μg/mL, corresponding to a specific activity is ≥6.19×102 units/mg.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH11989.1/Q9NQ30-1 (W20-R184 )

Gene ID
Molecular Construction
N-term
ESM-1 (W20-R184 )
Accession # AAH11989.1
6*His
C-term
Synonyms
rHuEndothelial cell-specific molecule 1/ESM-1, His; Endothelial Cell-Specific Molecule 1; ESM-1; ESM1
AA Sequence

WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Molecular Weight

Approximately 20-26 kDa due to the glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ESM-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ESM-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70151
Quantity:
MCE Japan Authorized Agent: