EVI2A Protein, Human (HEK293, Fc)

EVI2A may be a component of a cell surface receptor that forms a complex with itself or other proteins within the membrane, suggesting a role in mediating cellular responses through complex molecular interactions. Its ability to participate in self-complex formation or to interact with other proteins implies involvement in the organization of membrane-associated receptor structures. EVI2A Protein, Human (HEK293, Fc) is the recombinant human-derived EVI2A protein, expressed by HEK293 , with C-hFc labeled tag.

The EVI2A protein emerges as a potential integral component of cell-surface receptors, as it may form complexes with itself or other proteins within the membrane. This suggests a role in mediating cellular responses through intricate molecular interactions. The ability of EVI2A to engage in self-complex formation or interaction with other proteins implies its participation in the constitution of membrane-associated receptor structures. Further exploration is needed to elucidate the specific partners and signaling pathways in which EVI2A is involved, shedding light on its significance in cellular communication and the intricate regulation of cell-surface events.

Human

HEK293

C-hFc

P22794-1/NP_055025.2 (N31-M133)

2123  [NCBI]

NYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNM

Approximately 70-80 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.