1. Recombinant Proteins
  2. Others
  3. FABP1/L-FABP Protein, Mouse (His)

FABP1/L-FABP Protein, Mouse (His)

Cat. No.: HY-P71935A
SDS COA Handling Instructions

FABP1/L-FABP Protein facilitates cholesterol uptake in hepatocytes via lipoproteins, binding cholesterol, free fatty acids, coenzyme A derivatives, bilirubin, and small molecules within the cytoplasm. It may also participate in intracellular lipid transport processes. FABP1/L-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP1/L-FABP Protein, Mouse (His) is 127 a.a., with molecular weight of ~15 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP1/L-FABP Protein facilitates cholesterol uptake in hepatocytes via lipoproteins, binding cholesterol, free fatty acids, coenzyme A derivatives, bilirubin, and small molecules within the cytoplasm. It may also participate in intracellular lipid transport processes. FABP1/L-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP1/L-FABP Protein, Mouse (His) is 127 a.a., with molecular weight of ~15 kDa.

Background

The FABP1/L-FABP protein plays a crucial role in facilitating the uptake of cholesterol by hepatocytes through lipoproteins. It has the ability to bind cholesterol, as well as other molecules like free fatty acids and their coenzyme A derivatives, bilirubin, and various small molecules within the cytoplasm. Moreover, there is a potential involvement of FABP1/L-FABP in intracellular lipid transport processes.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P12710 (M1-I127)

Gene ID
Molecular Construction
N-term
6*His
FABP1 (M1-I127)
Accession # P12710
C-term
Synonyms
Fabp1; FabplFatty acid-binding protein; liver; 14 kDa selenium-binding protein; Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP
AA Sequence

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Molecular Weight

Approximately 15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

FABP1/L-FABP Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP1/L-FABP Protein, Mouse (His)
Cat. No.:
HY-P71935A
Quantity:
MCE Japan Authorized Agent: