FABP1/L-FABP Protein, Mouse (His)

FABP1/L-FABP Protein facilitates cholesterol uptake in hepatocytes via lipoproteins, binding cholesterol, free fatty acids, coenzyme A derivatives, bilirubin, and small molecules within the cytoplasm. It may also participate in intracellular lipid transport processes. FABP1/L-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP1/L-FABP Protein, Mouse (His) is 127 a.a., with molecular weight of ~15 kDa.

The FABP1/L-FABP protein plays a crucial role in facilitating the uptake of cholesterol by hepatocytes through lipoproteins. It has the ability to bind cholesterol, as well as other molecules like free fatty acids and their coenzyme A derivatives, bilirubin, and various small molecules within the cytoplasm. Moreover, there is a potential involvement of FABP1/L-FABP in intracellular lipid transport processes.

Mouse

E. coli

N-6*His

P12710 (M1-I127)

14080  [NCBI]

MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.