1. Recombinant Proteins
  2. Others
  3. FABP5 Protein, Human (His)

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP5 Protein, Human (His) is 134 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP5 acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism. It selectively delivers specific fatty acids from the cytoplasm to the nucleus, activating nuclear receptors including peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 Protein, Human (His) is the recombinant human-derived FABP5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FABP5 Protein, Human (His) is 134 a.a., with molecular weight of ~17 kDa.

Background

FABP5 functions as an intracellular carrier for long-chain fatty acids and related active lipids, including endocannabinoids, thereby regulating the metabolism and actions of the ligands they bind. In addition to its role in cytosolic transport, FABP5 selectively delivers specific fatty acids from the cytosol to the nucleus, where they activate nuclear receptors. Notably, it delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta, promoting proliferation and survival. FABP5 may also serve as a synaptic carrier of endocannabinoids at central synapses, thereby controlling retrograde endocannabinoid signaling. Furthermore, it modulates inflammation by regulating PTGES induction via NF-kappa-B activation and prostaglandin E2 (PGE2) biosynthesis during inflammatory processes. Additionally, FABP5's potential involvement in keratinocyte differentiation has been suggested.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q01469 (A2-E135)

Gene ID
Molecular Construction
N-term
6*His
FABP5 (A2-E135)
Accession # Q01469
C-term
Synonyms
Fatty acid-binding protein 5; E-FABP; PA-FABP; FABP5
AA Sequence

ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FABP5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP5 Protein, Human (His)
Cat. No.:
HY-P72660
Quantity:
MCE Japan Authorized Agent: