1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FAM3C Protein, Human (HEK293, His)

The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FAM3C Protein emerges as a potential contributor to distinct cellular processes, with suggested involvement in retinal laminar formation, emphasizing its role in retinal development. Additionally, FAM3C is implicated in promoting epithelial to mesenchymal transition (EMT), indicating its potential impact on cellular differentiation and tissue remodeling. The dual nature of FAM3C's functions, spanning retinal development and EMT processes, underscores its versatility in influencing fundamental aspects of cellular behavior. Delving deeper into the specific mechanisms by which FAM3C modulates retinal laminar formation and EMT could provide valuable insights into its role in tissue development and remodeling, offering potential avenues for understanding its broader implications in physiological and pathological contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q92520 (Q25-D227)

Gene ID
Molecular Construction
N-term
FAM3C (Q25-D227)
Accession # Q92520
6*His
C-term
Synonyms
Protein FAM3C; Interleukin-Like EMT Inducer; FAM3C; ILEI
AA Sequence

QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Molecular Weight

20-25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or 20 mM Citrate, 8% Trehaolse, 5% Mannitol, 0.05% Tween 80, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FAM3C Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FAM3C Protein, Human (HEK293, His)
Cat. No.:
HY-P70885
Quantity:
MCE Japan Authorized Agent: