1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FcγRIIB/CD32b
  6. Fc gamma RIIB/CD32b Protein, Human (HEK293, His)

Fc gamma RIIB/CD32b Protein, Human (HEK293, His)

Cat. No.: HY-P70491
SDS COA Handling Instructions Technical Support

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIB, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 753.3 ng/mL, corresponding to a specific activity is 1327.5 Unit/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIB, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 753.3 ng/mL, corresponding to a specific activity is 1327.5 Unit/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P31994-1 (T43-P217)

Gene ID
Molecular Construction
N-term
CD32b (T43-P217)
Accession # P31994-1
6*His
C-term
Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; Fc-Gamma RII-b; Fc-Gamma-RIIb; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
AA Sequence

TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

Molecular Weight

25-30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2-7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIB/CD32b Protein, Human (HEK293, His)
Cat. No.:
HY-P70491
Quantity:
MCE Japan Authorized Agent: