Fc gamma RIIB/CD32b Protein, Human (HEK293, His)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-6*His labeled tag.

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIB, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 753.3 ng/mL, corresponding to a specific activity is 1327.5 Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human FcγRIIB, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED₅₀ for this effect is 753.3 ng/mL, corresponding to a specific activity is 1327.5 Unit/mg.

Human

HEK293

C-6*His

P31994-1 (T43-P217)

2213  [NCBI]

TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

25-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2-7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.