Fetuin A/AHSG Protein, Human (HEK293, His)

Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Fetuin A/AHSG Protein, Human (HEK293, His) is 349 a.a., with molecular weight of ~60.0 kDa.

Fetuin A, also known as AHSG Protein, emerges as a multifaceted player in cellular processes, actively promoting endocytosis and displaying opsonic properties. Its influence extends to the modulation of the mineral phase of bone, reflecting its role in bone homeostasis. With a notable affinity for calcium and barium ions, Fetuin A contributes to ion interactions within cellular environments. The precursor gives rise to the alpha-2-HS glycoprotein upon cleavage of the connecting peptide, and the two chains A and B are intricately linked by a single disulfide bond. This molecular architecture underscores the structural complexity of Fetuin A and its potential impact on various physiological processes, warranting further investigation to unveil the detailed mechanisms underlying its diverse functionalities in cellular and bone biology.

Measured by its ability to inhibit calcium phosphate precipitation. The IC₅₀ value is 46.163 μg/mL, as measured under the described conditions.

Human

HEK293

C-6*His

AAH48198.1/NP_001613.2 (A19-V367)

197  [NCBI]

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Approximately 60.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.