1. Recombinant Proteins
  2. Others
  3. Fetuin A/AHSG Protein, Human (HEK293, His)

Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Fetuin A/AHSG Protein, Human (HEK293, His) is 349 a.a., with molecular weight of ~60.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Fetuin A/AHSG Protein, Human (HEK293, His) is 349 a.a., with molecular weight of ~60.0 kDa.

Background

Fetuin A, also known as AHSG Protein, emerges as a multifaceted player in cellular processes, actively promoting endocytosis and displaying opsonic properties. Its influence extends to the modulation of the mineral phase of bone, reflecting its role in bone homeostasis. With a notable affinity for calcium and barium ions, Fetuin A contributes to ion interactions within cellular environments. The precursor gives rise to the alpha-2-HS glycoprotein upon cleavage of the connecting peptide, and the two chains A and B are intricately linked by a single disulfide bond. This molecular architecture underscores the structural complexity of Fetuin A and its potential impact on various physiological processes, warranting further investigation to unveil the detailed mechanisms underlying its diverse functionalities in cellular and bone biology.

Biological Activity

Measured by its ability to inhibit calcium phosphate precipitation. The IC50 value is 46.163 μg/mL, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH48198.1/NP_001613.2 (A19-V367)

Gene ID

197  [NCBI]

Molecular Construction
N-term
AHSG (A19-V367)
Accession # AAH48198.1
6*His
C-term
Synonyms
rHuAlpha-2-HS-glycoprotein/AHSG, His; Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA
AA Sequence

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Molecular Weight

Approximately 60.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fetuin A/AHSG Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fetuin A/AHSG Protein, Human (HEK293, His)
Cat. No.:
HY-P70170
Quantity:
MCE Japan Authorized Agent: