FGF-23 Protein, Rat (His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (His) is the recombinant rat-derived FGF-23 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FGF-23 Protein, Rat (His) is 227 a.a., with molecular weight of ~29.5 kDa.

FGF-23 Protein serves as a pivotal regulator of phosphate homeostasis, exerting its effects by inhibiting renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in regulating vitamin-D metabolism. Furthermore, FGF-23 Protein negatively modulates osteoblasts differentiation and matrix mineralization. It directly influences the parathyroid to decrease the secretion of parathyroid hormone. FGF-23 Protein also up-regulates EGR1 expression in the presence of KL. Moreover, it interacts with FGFR1, FGFR2, FGFR3, and FGFR4, and the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED₅₀ for this effect is 27-51.77 ng/mL in the presence of 1 μg/mL murine Klotho and 100μg/mL heparin.

Rat

E. coli

N-6*His

Q8VI82 (Y25-V251)

170583  [NCBI]

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Approximately 29.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.