1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-23
  6. FGF-23 Protein, Rat (His)

FGF-23 Protein, Rat (His)

Cat. No.: HY-P72195
COA Handling Instructions

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (His) is the recombinant rat-derived FGF-23 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FGF-23 Protein, Rat (His) is 227 a.a., with molecular weight of ~29.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $38 In-stock
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

FGF-23 Protein, Rat (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (His) is the recombinant rat-derived FGF-23 protein, expressed by E. coli , with N-6*His labeled tag. The total length of FGF-23 Protein, Rat (His) is 227 a.a., with molecular weight of ~29.5 kDa.

Background

FGF-23 Protein serves as a pivotal regulator of phosphate homeostasis, exerting its effects by inhibiting renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in regulating vitamin-D metabolism. Furthermore, FGF-23 Protein negatively modulates osteoblasts differentiation and matrix mineralization. It directly influences the parathyroid to decrease the secretion of parathyroid hormone. FGF-23 Protein also up-regulates EGR1 expression in the presence of KL. Moreover, it interacts with FGFR1, FGFR2, FGFR3, and FGFR4, and the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, acting as coreceptors.

Biological Activity

Determined by its ability to stimulate the proliferation of murine NIH-3T3 cells. The ED50 for this effect is 27-51.77 ng/mL in the presence of 1 μg/mL murine Klotho and 100μg/mL heparin.

Species

Rat

Source

E. coli

Tag

N-6*His

Accession

Q8VI82 (Y25-V251)

Gene ID
Molecular Construction
N-term
6*His
FGF-23 (Y25-V251)
Accession # Q8VI82
C-term
Synonyms
Fgf23Fibroblast growth factor 23; FGF-23
AA Sequence

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Weight

Approximately 29.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-23 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-23 Protein, Rat (His)
Cat. No.:
HY-P72195
Quantity:
MCE Japan Authorized Agent: