1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 7 (FGF-7)
  6. KGF/FGF-7 Protein, Mouse (Tag free)

KGF/FGF-7 Protein, Mouse (Tag free)

Cat. No.: HY-P7176
COA Handling Instructions

FGF-7 Protein, Mouse (His) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $73 In-stock
10 μg $190 In-stock
50 μg $590 In-stock
100 μg $1000 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FGF-7 Protein, Mouse (His) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.

Background

Fibroblast growth factor-7 (FGF-7) is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung[1]. FGF-7, also known as keratinocyte growth factor, insofar as it displays a unique cell specificity. FGF7 binds to perlecan protein core and that exogenous perlecan efficiently reconstitutes FGF7 mitogenic activity in perlecan-deficient cells[2].

Biological Activity

The ED50 is ≤10 ng/mL as measured by 4MBr-5 cells, corresponding to a specific activity of ≥1 × 105 units/mg.

  • Measured in a cell proliferation assay using 4MBr 5 rhesus monkey epithelial cells. The ED50 for this effect is 8.477 ng/mL, corresponding to a specific activity is 1.18×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P36363 (C32-T194)

Gene ID
Molecular Construction
N-term
FGF-7 (C32-T194)
Accession # P36363
C-term
Synonyms
rMuFGF-7; HBGF-7; KGF
AA Sequence

CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Molecular Weight

Approximately 18.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

KGF/FGF-7 Protein, Mouse (Tag free) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF/FGF-7 Protein, Mouse (Tag free)
Cat. No.:
HY-P7176
Quantity:
MCE Japan Authorized Agent: