1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-8
  6. FGF-8b Protein, Human/Mouse

FGF-8b Protein, Human/Mouse is the recombinant mouse, human-derived FGF-8b protein, expressed by E. coli , with tag free. The total length of FGF-8b Protein, Human/Mouse is 193 a.a., with molecular weight of 21-24 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF-8b Protein, Human/Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-8b Protein, Human/Mouse is the recombinant mouse, human-derived FGF-8b protein, expressed by E. coli , with tag free. The total length of FGF-8b Protein, Human/Mouse is 193 a.a., with molecular weight of 21-24 kDa.

Biological Activity

1.Measured in a cell proliferation assay using BALB/c 3T3 cells and the special bioactivity is <40.58 ng/mL.
2.Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 20-60 ng/mL in the presence of 1 µg/mL heparin.

  • Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is typically 51.21 ng/mL in the presence of 1 µg/mL heparin,corresponding to a specific activity is 1.95×10^4 U/mg.
Species

Mouse; Human

Source

E. coli

Tag

Tag Free

Accession

P55075-3/P37237-2 (Q23-R215)

Gene ID
Molecular Construction
N-term
FGF-8b (Q23-R215)
Accession # P55075-3
C-term
Synonyms
Fibroblast growth factor 8; Androgen-induced growth factor; Heparin-binding growth factor 8; AIGF; HBGF-8; FGF-8B
AA Sequence

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Weight

Approximately 23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB, 300 mM NaCl, 2% Sucrose, 0.02% Tween 80, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-8b Protein, Human/Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-8b Protein, Human/Mouse
Cat. No.:
HY-P70533
Quantity:
MCE Japan Authorized Agent: