FGF-8c Protein, Mouse (His)

FGF-8c Protein, Mouse is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Fibroblast Growth Factor 8 is an essential factor during embryonic development, overexpressed in several tumor types. Fibroblast Growth Factor 8 stimulates anti-apoptotic pathways and prevents tumor cell death^[1].

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 53.76 ng/mL, corresponding to a specific activity is 1.860×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 53.76 ng/mL, corresponding to a specific activity is 1.860×10⁴ units/mg.

Mouse

E. coli

N-6*His

P37237 (Q23-R268)

14179  [NCBI]

QVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Approximately 29 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.