1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. FGFR-3 FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Mouse (HEK293, His-Fc)

The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine, and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification, acting as a negative regulator of long bone growth. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway[1][2][3][4][5][6].

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

Q7TSI8 (E21-Y367)

Gene ID
Molecular Construction
N-term
FGFR-3 (E21-Y367)
Accession # Q7TSI8
hFc-His
C-term
Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; JTK4
AA Sequence

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

Molecular Weight

100-110 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGFR-3 Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-3 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P73056
Quantity:
MCE Japan Authorized Agent: