FGFR-3 Protein, Mouse (HEK293, His-Fc)

The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine, and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification, acting as a negative regulator of long bone growth. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway^{[1][2][3][4][5][6]}.

Mouse

HEK293

C-hFc;C-His

Q7TSI8 (E21-Y367)

14184  [NCBI]

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

100-110 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.