1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules
  4. FGL-1
  5. FGL1 Protein, Human (Biotinylated, HEK293, Avi-His)

FGL1 Protein, Human (Biotinylated, HEK293, Avi-His)

Cat. No.: HY-P72369
Handling Instructions Technical Support

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

FGL1 protein functions as an immune suppressive molecule, exerting inhibitory effects on antigen-specific T-cell activation by serving as a major ligand for LAG3. It plays a pivotal role in mediating LAG3's T-cell inhibitory function independently of MHC class II (MHC-II) binding. Beyond its immune-regulatory role, FGL1 is secreted by hepatocytes, contributing to their growth. Existing as a homodimer, FGL1 interacts with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This molecular interaction, detailed in studies, underscores the significance of FGL1 in modulating immune responses and hepatocyte growth, highlighting its potential as a key player in the regulation of T-cell activation and hepatic functions.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q08830 (L23-I312)

Gene ID
Molecular Construction
N-term
FGL1 (L23-I312)
Accession # Q08830
Avi-6*His
C-term
Synonyms
Fibrinogen-like protein 1; FGL1; HP-041; Hepassocin; HFREP-1; LFIRE-1
AA Sequence

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Weight

Approximately 35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGL1 Protein, Human (Biotinylated, HEK293, Avi-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGL1 Protein, Human (Biotinylated, HEK293, Avi-His)
Cat. No.:
HY-P72369
Quantity:
MCE Japan Authorized Agent: