FGL1 Protein, Mouse (HEK293, hFc)

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

The FGL1 protein is predicted to have signaling receptor binding activity and is involved in the negative regulation of T cell activation and immune response. It plays a role upstream or within various processes, including adipose tissue development, cholesterol metabolic process, and response to stilbenoid. The protein is located in the extracellular region and is orthologous to the human FGL1 (fibrinogen like 1) gene. Additionally, it exhibits restricted expression primarily in the liver at E18 stage.

Immobilized Mouse LAG-3, hFc Tag (HY-P73843) at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED₅₀ for this effect is 0.5343 μg/mL, corresponding to a specific activity is 1.87×10³ Unit/mg.

• 
  Immobilized Mouse LAG-3, hFc Tag (HY-P73843) at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED₅₀ for this effect is 0.5343 μg/mL, corresponding to a specific activity is 1.87×10³ Unit/mg.

Mouse

HEK293

C-hFc

NP_663569.2 (L23-I314)

234199  [NCBI]

LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

Approximately 60.08 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 (Normally trehalose is added as protectant before lyophilization. ) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.