FKBP11 Protein, Human (HEK293, Fc)

The FKBP11 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that plays a crucial role in accelerating protein folding, especially in complex protein synthesis. FKBP11 uses its enzymatic abilities to promote rapid and precise conformational changes that are critical for correct protein folding and maturation. FKBP11 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP11 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of FKBP11 Protein, Human (HEK293, Fc) is 128 a.a., with molecular weight of ~40.4-45 KDa.

FKBP11 Protein takes center stage as a peptidyl-prolyl cis-trans isomerase (PPIase) that plays a crucial role in expediting the folding of proteins, particularly within the intricate context of protein synthesis. Harnessing its enzymatic prowess, FKBP11 facilitates the rapid and precise conformational changes necessary for the correct folding and maturation of proteins. As a member of the PPIase family, FKBP11 adeptly catalyzes the cis-trans isomerization of proline imidic peptide bonds, thus influencing the dynamic structural transitions of nascent or misfolded polypeptides. This functional attribute underscores the protein's vital contribution to maintaining cellular protein homeostasis, hinting at its potential impact on diverse cellular processes. Further exploration is warranted to uncover the specific molecular mechanisms through which FKBP11 actively engages in the intricate ballet of protein folding during synthesis.

Specific activity is 3735.130 nmoL/min/mg, and is defined as the amount of enzyme that cleaves 1 nmole of suc-AAPF-pNA per minute at 37°C in Tris-HCl pH 8.0 using chymotrypsin.

Human

HEK293

C-mFc

Q9NYL4 (G28-G155)

51303  [NCBI]

GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKG

Approximately 40.4-45 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.