1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP11 Protein, Human (HEK293, Fc)

The FKBP11 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that plays a crucial role in accelerating protein folding, especially in complex protein synthesis. FKBP11 uses its enzymatic abilities to promote rapid and precise conformational changes that are critical for correct protein folding and maturation. FKBP11 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP11 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of FKBP11 Protein, Human (HEK293, Fc) is 128 a.a., with molecular weight of ~40.4-45 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FKBP11 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that plays a crucial role in accelerating protein folding, especially in complex protein synthesis. FKBP11 uses its enzymatic abilities to promote rapid and precise conformational changes that are critical for correct protein folding and maturation. FKBP11 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP11 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of FKBP11 Protein, Human (HEK293, Fc) is 128 a.a., with molecular weight of ~40.4-45 KDa.

Background

FKBP11 Protein takes center stage as a peptidyl-prolyl cis-trans isomerase (PPIase) that plays a crucial role in expediting the folding of proteins, particularly within the intricate context of protein synthesis. Harnessing its enzymatic prowess, FKBP11 facilitates the rapid and precise conformational changes necessary for the correct folding and maturation of proteins. As a member of the PPIase family, FKBP11 adeptly catalyzes the cis-trans isomerization of proline imidic peptide bonds, thus influencing the dynamic structural transitions of nascent or misfolded polypeptides. This functional attribute underscores the protein's vital contribution to maintaining cellular protein homeostasis, hinting at its potential impact on diverse cellular processes. Further exploration is warranted to uncover the specific molecular mechanisms through which FKBP11 actively engages in the intricate ballet of protein folding during synthesis.

Biological Activity

Specific activity is 3735.130 nmoL/min/mg, and is defined as the amount of enzyme that cleaves 1 nmole of suc-AAPF-pNA per minute at 37°C in Tris-HCl pH 8.0 using chymotrypsin.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q9NYL4 (G28-G155)

Gene ID
Molecular Construction
N-term
FKBP11 (G28-G155)
Accession # Q9NYL4
mFc
C-term
Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; FKBP-19; Rotamase; FKBP-11
AA Sequence

GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKG

Molecular Weight

Approximately 40.4-45 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FKBP11 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP11 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76344
Quantity:
MCE Japan Authorized Agent: