FKBP2 Protein, Human (HEK293, His)

FKBP2 protein plays a central role in the complex process of protein folding and is an important peptidyl prolyl cis-trans isomerase (PPIase). Its unique ability to catalyze the cis-trans isomerization of proline imide peptide bonds accelerates dynamic conformational changes that are critical for efficient protein folding. FKBP2 Protein, Human (HEK293, His) is the recombinant human-derived FKBP2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP2 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~17.0 kDa.

FKBP2 Protein takes center stage as a pivotal participant in the intricate process of protein folding, showcasing its essential role as a peptidyl-prolyl cis-trans isomerase (PPIase). With a distinctive capacity to catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, FKBP2 actively accelerates the dynamic conformational changes crucial for the efficient folding of proteins. This enzymatic activity underscores FKBP2's significance in facilitating the correct maturation and structural integrity of nascent or misfolded polypeptides, thereby contributing to the overall maintenance of cellular protein homeostasis. As a member of the PPIase family, FKBP2 plays a fundamental role in the intricate ballet of protein folding, warranting further exploration to unravel the specific molecular mechanisms and cellular contexts through which FKBP2 actively engages in this crucial cellular process.

Human

HEK293

C-6*His

P26885 (A22-L142)

2286  [NCBI]

ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.