1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP2 Protein, Human (HEK293, His)

FKBP2 protein plays a central role in the complex process of protein folding and is an important peptidyl prolyl cis-trans isomerase (PPIase). Its unique ability to catalyze the cis-trans isomerization of proline imide peptide bonds accelerates dynamic conformational changes that are critical for efficient protein folding. FKBP2 Protein, Human (HEK293, His) is the recombinant human-derived FKBP2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP2 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FKBP2 protein plays a central role in the complex process of protein folding and is an important peptidyl prolyl cis-trans isomerase (PPIase). Its unique ability to catalyze the cis-trans isomerization of proline imide peptide bonds accelerates dynamic conformational changes that are critical for efficient protein folding. FKBP2 Protein, Human (HEK293, His) is the recombinant human-derived FKBP2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP2 Protein, Human (HEK293, His) is 121 a.a., with molecular weight of ~17.0 kDa.

Background

FKBP2 Protein takes center stage as a pivotal participant in the intricate process of protein folding, showcasing its essential role as a peptidyl-prolyl cis-trans isomerase (PPIase). With a distinctive capacity to catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, FKBP2 actively accelerates the dynamic conformational changes crucial for the efficient folding of proteins. This enzymatic activity underscores FKBP2's significance in facilitating the correct maturation and structural integrity of nascent or misfolded polypeptides, thereby contributing to the overall maintenance of cellular protein homeostasis. As a member of the PPIase family, FKBP2 plays a fundamental role in the intricate ballet of protein folding, warranting further exploration to unravel the specific molecular mechanisms and cellular contexts through which FKBP2 actively engages in this crucial cellular process.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P26885 (A22-L142)

Gene ID
Molecular Construction
N-term
FKBP2 (A22-L142)
Accession # P26885
6*His
C-term
Synonyms
rHuPeptidyl-prolyl cis-trans isomerase FKBP2 Gene/FKBP2, His; Peptidyl-prolyl cis-trans isomerase FKBP2(FKBP2 for short); also named 13 kDa FK506-binding protein; FK506-binding protein 2; Immunophilin FKBP13; Rotamase
AA Sequence

ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FKBP2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70333
Quantity:
MCE Japan Authorized Agent: