1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FLT3LG Protein, Human (CHO)

FLT3LG Protein, Human (CHO)

Cat. No.: HY-P7111
SDS COA Handling Instructions

FLT3LG Protein, Human (CHO) is a cytokine, which can promote the generation and differentiation of hematopoietic stem cells and their progenitor cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FLT3LG Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FLT3LG Protein, Human (CHO) is a cytokine, which can promote the generation and differentiation of hematopoietic stem cells and their progenitor cells.

Background

Fms-related tyrosine kinase 3 ligand is a type of cell factor, able to promote the generation and differentiation of hematopoietic stem cells and their progenitor cells. The mRNA of Fms-related tyrosine kinase 3 ligand is highly expressed in certain tissues, including peripheral blood mononuclear cells, the heart, placenta, lung, spleen and thymus tissue, and is also expressed to a certain extent in non-hematopoietic tissues, including the prostate, testis, ovaries, intestines, liver, kidney and skeletal muscle[1].

Biological Activity

1.The ED50 is <1 ng/mL as measured by human AML5 cells, corresponding to a specific activity of >1 × 106 units/mg.
2.Measured in a cell proliferation assay using HL-60 cells. The ED50 for this effect is 0.9476 ng/mL, corresponding to a specific activity is 1.055×106 units/mg.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P49771-1 (T27-P185)

Gene ID
Molecular Construction
N-term
FLT3LG (T27-P185)
Accession # P49771-1
C-term
Synonyms
rHuFlt-3 Ligand; Flt3 ligand; FL; SL cytokine; Flt-3L
AA Sequence

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Molecular Weight

Approximately 18-22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FLT3LG Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FLT3LG Protein, Human (CHO)
Cat. No.:
HY-P7111
Quantity:
MCE Japan Authorized Agent: