FOLR1 Protein, Mouse (HEK293, His)

FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FOLR1 Protein, Mouse (HEK293, His) is 208 a.a., with molecular weight of 33-37 kDa.

The FOLR1 protein binds to folate and reduced folic acid derivatives, facilitating the delivery of 5-methyltetrahydrofolate and folate analogs into cells. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. Upon endocytosis and exposure to slightly acidic pH, a conformational change occurs, leading to a significant reduction in its affinity for folates and subsequent release. This protein is essential for normal embryonic development, cell proliferation, and renal folate reabsorption.

Mouse

HEK293

C-6*His

P35846 (T25-S232)

14275  [NCBI]

TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMS

33-37 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.