1. Recombinant Proteins
  2. Others
  3. FOXM1 Protein, Human (His, SUMO-Myc)

FOXM1 Protein, Human (His, SUMO-Myc)

Cat. No.: HY-P72197
SDS COA Handling Instructions

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FOXM1 is an important transcription factor that controls cell cycle gene expression critical for DNA replication and mitosis, underscoring its critical role in cellular processes. In addition to cell proliferation, FOXM1 contributes to DNA break repair and DNA damage checkpoint responses. FOXM1 Protein, Human (His, SUMO-Myc) is the recombinant human-derived FOXM1 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.

Background

FOXM1, a crucial transcription factor, governs the expression of cell cycle genes vital for DNA replication and mitosis, underscoring its pivotal role in orchestrating cellular processes. Beyond its involvement in cell proliferation control, FOXM1 also contributes to DNA break repair, actively participating in the DNA damage checkpoint response. Notably, FOXM1 promotes the transcription of PHB2, emphasizing its diverse regulatory functions. Furthermore, FOXM1 interacts with PINT87aa, a product encoded by the circular form of the long non-coding RNA LINC-PINT, and this interaction serves to inhibit FOXM1-mediated transcription of PHB2, revealing an intricate layer of regulatory control in cellular transcriptional processes.

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc;N-SUMO

Accession

Q08050-1 (E235-L327)

Gene ID
Molecular Construction
N-term
10*His
FOXM1 (E235-L327)
Accession # Q08050-1
Myc
C-term
Synonyms
FKHL16; Forkhead box M1; Forkhead box protein M1; forkhead like 16; Forkhead-related protein FKHL16; FOX M1; Foxm1; FOXM1_HUMAN; FOXM1B; HFH-11; HFH11; HNF-3/fork-head homolog 11; HNF3; INS1; M phase phosphoprotein 2; M-phase phosphoprotein 2; MPHOSPH2; MPP2; PIG29; TGT3; Transcription factor Trident; Trident; WIN; Winged-helix factor from INS1 cells
AA Sequence

ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL

Molecular Weight

Approximately 31.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

FOXM1 Protein, Human (His, SUMO-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FOXM1 Protein, Human (His, SUMO-Myc)
Cat. No.:
HY-P72197
Quantity:
MCE Japan Authorized Agent: