Fractalkine/CX3CL1 Protein, Human

Fractalkine/CX3CL1 Protein, Human is found to be associated with inflammatory diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV).

Fractalkine/CX3CL1 exists in two forms: as a membrane-anchored or as a shed 80-95K glycoprotein. Fractalkine/CX3CL1 is expressed in monocytes during inflammatory conditions. Fractalkine/CX3CL1 is also expressed in macrophages, fibroblasts, endothelial, and dendritic cells in rheumatoid arthritis (RA) synovial tissue. CX3CL1 is associated with the development of different diseases such as rheumatoid arthritis (RA), rheumatoid vasculitis (RV), Sjögren’s syndrome (SS), systemic lupus erythematosus (SLE), scleroderma, multiple sclerosis, and atherosclerosis^[1].

1.Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 5.0-10 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 7.841 ng/mL, corresponding to a specific activity is 1.275×10⁵ U/mg.

Human

E. coli

Tag Free

P78423 (Q25-G100)

6376  [NCBI]

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Approximately 8.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 50 mM NaCl or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jones BA, et al. Fractalkine/CX3CL1: a potential new target for inflammatory diseases. Mol Interv. 2010 Oct;10(5):263-70.  [Content Brief]