Frizzled-8 Protein, Human (HEK293, His)

Frizzled-8 is a Wnt receptor that critically coordinates β-catenin signaling through the complex Wnt-Fzd-LRP5-LRP6 complex. It acts through the canonical Wnt/β-catenin pathway, activating scrambled proteins, inhibiting GSK-3 kinase, inducing nuclear β-catenin accumulation, and activating Wnt target genes. Frizzled-8 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Frizzled-8 Protein, Human (HEK293, His) is 145 a.a., with molecular weight of 22-32 kDa.

Frizzled-8, functioning as a receptor for Wnt proteins, plays a pivotal role in the intricate Wnt-Fzd-LRP5-LRP6 complex, orchestrating beta-catenin signaling by inducing the aggregation of receptor-ligand complexes into signalosomes of ribosome size. Operating primarily through the canonical Wnt/beta-catenin signaling pathway, it prompts the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and activates Wnt target genes. An additional signaling pathway involving PKC and calcium fluxes has been observed in some family members, although the extent of its integration with the canonical pathway remains unclear. Frizzled-8 may contribute to transducing polarity information during tissue morphogenesis and in differentiated tissues. As a coreceptor alongside RYK for Wnt proteins like WNT1, it actively participates in the formation of a Wnt-signaling complex, engaging with WNT proteins, FZD proteins, and LRP5 or LRP6. The interactions with GPOC, RSPO1, RSPO3, and glypican GPC3 further underscore its intricate involvement in diverse cellular processes.

Human

HEK293

C-6*His

Q9H461 (A28-P172)

8325  [NCBI]

ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPP

22-32 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.