1. Recombinant Proteins
  2. Others
  3. Frizzled-9 Protein, Mouse (HEK293, mFc)

Frizzled-9 Protein, Mouse (HEK293, mFc)

Cat. No.: HY-P79115
COA Handling Instructions

Frizzled-9, a WNT2 receptor, crucially activates the beta-catenin pathway, involving disheveled protein activation, GSK-3 kinase inhibition, nuclear beta-catenin accumulation, and Wnt target gene activation. Beyond canonical signaling, it negatively regulates acetylcholine receptor clustering in neuromuscular junction assembly and influences neural progenitor cell viability by regulating the cell cycle. In hippocampal development, Frizzled-9 regulates neuroblast proliferation and apoptosis. Additionally, it plays a pivotal role in bone dynamics, modulating bone formation and regeneration through non-canonical Wnt signaling pathways. Frizzled-9 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived Frizzled-9 protein, expressed by HEK293, with C-mFc labeled tag. The total length of Frizzled-9 Protein, Mouse (HEK293, mFc) is 163 a.a., with molecular weight of 52-61 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $80 In-stock
10 μg $135 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-9, a WNT2 receptor, crucially activates the beta-catenin pathway, involving disheveled protein activation, GSK-3 kinase inhibition, nuclear beta-catenin accumulation, and Wnt target gene activation. Beyond canonical signaling, it negatively regulates acetylcholine receptor clustering in neuromuscular junction assembly and influences neural progenitor cell viability by regulating the cell cycle. In hippocampal development, Frizzled-9 regulates neuroblast proliferation and apoptosis. Additionally, it plays a pivotal role in bone dynamics, modulating bone formation and regeneration through non-canonical Wnt signaling pathways. Frizzled-9 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived Frizzled-9 protein, expressed by HEK293, with C-mFc labeled tag. The total length of Frizzled-9 Protein, Mouse (HEK293, mFc) is 163 a.a., with molecular weight of 52-61 kDa.

Background

Frizzled-9, serving as the receptor for WNT2, is a crucial player in the beta-catenin canonical signaling pathway, orchestrating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Beyond its role in canonical Wnt signaling, Frizzled-9 exhibits multifaceted functions. It contributes to neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin pathway. In neural progenitor cells (NPCs), Frizzled-9 influences cell viability by negatively regulating cell cycle arrest, thereby inhibiting the apoptotic process. The receptor's involvement in hippocampal development includes the regulation of neuroblast proliferation and apoptotic cell death. Moreover, Frizzled-9 plays a pivotal role in bone dynamics, modulating bone formation through non-canonical Wnt signaling mediated via ISG15 and positively impacting bone regeneration through non-canonical Wnt signaling pathways.

Biological Activity

Measured by its ability to bind biotinylated mouse Wnt-3a in a funtional ELISA with an estimated Kd 2.263 nM.

  • Immobilized Frizzled-9 at 2 μg/mL (100 μL/well) can bind Biotinylated Mouse Wnt3a protein. The Kd is 2.263 nM.
Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

Q9R216 (L24-D186)

Gene ID
Molecular Construction
N-term
Frizzled-9 (L24-D186)
Accession # Q9R216
mFc
C-term
Synonyms
Frizzled-9; Fzd9; Fz-9; mFz3; mFz9; CD349; Fzd3
AA Sequence

LEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGD

Molecular Weight

52-61 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-9 Protein, Mouse (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-9 Protein, Mouse (HEK293, mFc)
Cat. No.:
HY-P79115
Quantity:
MCE Japan Authorized Agent: