FRZB Protein, Human (HEK293, His)

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

FRZB, a soluble frizzled-related protein (sFRP), assumes a pivotal role in modulating Wnt signaling through its direct interaction with Wnts, contributing to the regulation of cell growth and differentiation in specific cell types. Particularly, FRZB, also known as SFRP3, plays a crucial part in limb skeletogenesis, functioning as an antagonist of Wnt8 signaling. Its regulatory influence extends to the precise orchestration of chondrocyte maturation and long bone development. In addition to its involvement in Wnt signaling modulation, FRZB engages in molecular interactions, exemplified by its interaction with MYOC, thereby highlighting its diverse functions and importance in cellular processes. The multifaceted regulatory role of FRZB underscores its significance in the intricate landscape of Wnt-mediated pathways and skeletogenesis.

Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells. The ED₅₀ for this effect is 0.359 μg/mL, corresponding to a specific activity is 2.786×10³ units/mg.

Human

HEK293

C-His

Q92765/NP_001454.2 (A32-N325)

2487  [NCBI]

AAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

Approximately 41 kDa

Greater than 85% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.