1. Recombinant Proteins
  2. Others
  3. FRZB Protein, Human (HEK293, His)

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FRZB protein is a soluble Frizzled-related protein (sFRP) that modulates Wnt signaling by directly interacting with Wnt, thereby regulating cell growth and differentiation. FRZB, also known as SFRP3, plays a key role in limb skeletogenesis as a Wnt8 signaling antagonist. FRZB Protein, Human (HEK293, His) is the recombinant human-derived FRZB protein, expressed by HEK293 , with C-His labeled tag.

Background

FRZB, a soluble frizzled-related protein (sFRP), assumes a pivotal role in modulating Wnt signaling through its direct interaction with Wnts, contributing to the regulation of cell growth and differentiation in specific cell types. Particularly, FRZB, also known as SFRP3, plays a crucial part in limb skeletogenesis, functioning as an antagonist of Wnt8 signaling. Its regulatory influence extends to the precise orchestration of chondrocyte maturation and long bone development. In addition to its involvement in Wnt signaling modulation, FRZB engages in molecular interactions, exemplified by its interaction with MYOC, thereby highlighting its diverse functions and importance in cellular processes. The multifaceted regulatory role of FRZB underscores its significance in the intricate landscape of Wnt-mediated pathways and skeletogenesis.

Biological Activity

Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells. The ED50 for this effect is 0.359 μg/mL, corresponding to a specific activity is 2.786×103 units/mg.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q92765/NP_001454.2 (A32-N325)

Gene ID
Molecular Construction
N-term
FRZB (A32-N325)
Accession # Q92765/NP_001454.2
His
C-term
Synonyms
Secreted frizzled-related protein 3; sFRP-3; Frezzled; FrzB-1; FRZB; SFRP3
AA Sequence

AAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN

Molecular Weight

Approximately 41 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FRZB Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FRZB Protein, Human (HEK293, His)
Cat. No.:
HY-P75780
Quantity:
MCE Japan Authorized Agent: